Quiet essentials · Free shipping over $75 · Shop the edit

TBXA2R Polyclonal Antibody - E-AB-17492 Size:120μL Immunogen: A synthetic peptide of

SKU: 53815924145

4.2
USD100.10 USD132.10

Pay in 4 interest-free payments of $25.02 Learn more

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 24 - Aug 29

Description

Immunogen: A synthetic peptide of human GPR82(NP_543007

Upon binding to TRIB1

Alternative Name: JAG1

Target Synonym: HCRT

Sequence: MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN

TBXA2R Polyclonal Antibody - E-AB-17492 Size:120μL Immunogen: A synthetic peptide ofTBXA2R Polyclonal Antibody Sizes: 60L, 120L, 200L Catalogue Numbers: E AB 17492 60, E AB 17492 120, E AB 17492 200 Citations, Manuals and MSDS Available upon request. Abbreviation: TBXA2R Target Synonym: BDPLT13; Prostanoid TP receptor; TA2R; Tbxa2r; Thromboxane A2 receptor; TP receptor; TXA2 R; TXA2 R; TXA2R Research Areas: Cardiovascular, Metabolism Conjugation: Unconjugated Host: Rabbit Species Reactivity: Human Application: IHC, ELISA Isotype: IgG

Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy

You may also like

recommand products